Tfam Rabbit Polyclonal Antibody
Katalog-Nummer TA344229
Size : 100ul
Contact local distributor :
| Product Data | |
| Application | IHC, WB |
|---|---|
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Tfam antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 28 kDa |
| Gene Name | transcription factor A, mitochondrial |
| Database Link | |
| Background | The function remains unknown. |
| Synonyms | MTTF1; MtTF1; MTTFA; mtTFA; OTTHUMP00000019633; TCF6; TCF6L1; TCF6L2; TCF6L3 |
| Note | Immunogen Sequence Homology: Mouse: 100% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
|
| SDS |
| Antibody Resources |
|
Related Products
Check items to add to the cart or
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.