ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.||Source:|Recombinant protein corresponding to aa1-87 from saccharomyces cerevisiae ACB1, fused to His-Tag at N-terminal, expressed in Yeast.||Molecular Weight: |~12.1kD||AA Sequence:|MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.