ATP5B antibody - N-terminal region
Katalog-Nummer ARP48185_T100
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-ATP5F1B (ARP48185_T100) antibody |
---|
Publications | A Chinese herbal formula, Jian-Pi-Yi-Shen decoction, improves muscle atrophy via regulating mitochondrial quality control process in 5/6 nephrectomised rats. Sci Rep. 7, 9253 (2017). 288356711, 2081-2088 (2020). 328571051$s> Bannister, J. P. et al. Ca(V)1.2 channel N-terminal splice variants modulate functional surface expression in resistance size artery smooth muscle cells. J. Biol. Chem. 286, 15058-66 (2011). 213642841$s> | ||
---|---|---|---|
Tested Species Reactivity | Human, Mouse, Rat | ||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | IHC, WB | ||
Additional Information | IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B | ||
Purification | Protein A purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93% | ||
Peptide Sequence | Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ | ||
Concentration | 1.0 mg/ml | ||
Blocking Peptide | For anti-ATP5F1B (ARP48185_T100) antibody is Catalog # AAP48185 (Previous Catalog # AAPP28694) | ||
Subunit | beta, mitochondrial | ||
Enhanced Validation |
|
Reference | Vantourout,P., (2008) Mol. Immunol. 45 (2), 485-492 |
---|---|
Gene Symbol | ATP5F1B |
Gene Full Name | ATP synthase F1 subunit beta |
Alias Symbols | ATP5B, ATPMB, ATPSB, HEL-S-271 |
NCBI Gene Id | 506 |
Protein Name | ATP synthase subunit beta, mitochondrial |
Description of Target | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. |
Uniprot ID | P06576 |
Protein Accession # | NP_001677 |
Nucleotide Accession # | NM_001686 |
Protein Size (# AA) | 529 |
Molecular Weight | 57 kDa |
Protein Interactions | FUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT |