- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant DYRK1A.
Immunogen
DYRK1A (NP_001387, 674 a.a. ~ 763 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (99); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in K-562.Western Blot (Cell lysate)
DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in Raw 264.7.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DYRK1A is approximately 0.03ng/ml as a capture antibody.ELISA
- Gene Info — DYRK1A
Entrez GeneID
1859GeneBank Accession#
NM_001396Protein Accession#
NP_001387Gene Name
DYRK1A
Gene Alias
DYRK, DYRK1, HP86, MNB, MNBH
Gene Description
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Omim ID
600855Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms. [provided by RefSeq
Other Designations
MNB/DYRK protein kinase|OTTHUMP00000109090|dual specificity YAK1-related kinase|minibrain homolog|mnb protein kinase homolog hp86|protein kinase minibrain homolog|serine/threonine kinase MNB|serine/threonine-specific protein kinase
- Interactomes
- Diseases
- Publication Reference
- Prenatal treatment with preimplantation factor improves early postnatal neurogenesis and cognitive impairments in a mouse model of Down syndrome.
Manon Moreau, Rodolphe Dard, Amélia Madani, Janany Kandiah, Nadim Kassis, Jessica Ziga, Héloïse Castiglione, Solenn Day, Thomas Bourgeois, Boris Matrot, François Vialard, Nathalie Janel.
Cell Mol Life Sci. 2024 May; 81(1):215.
Application:WB, Mice, Mice brain.
- Chemical, Biochemical, Cellular, and Physiological Characterization of Leucettinib-21, a Down Syndrome and Alzheimer's Disease Drug Candidate.
Mattias F Lindberg, Emmanuel Deau, Frédéric Miege, Marie Greverie, Didier Roche, Nicolas George, Pascal George, Laura Merlet, Julie Gavard, Sander J T Brugman, Edwin Aret, Paul Tinnemans, René de Gelder, Jan Sadownik, Eva Verhofstad, Dennis Sleegers, Sara Santangelo, Julien Dairou, Álvaro Fernandez-Blanco, Mara Dierssen, Andreas Krämer, Stefan Knapp, Laurent Meijer.
Journal of Medicinal Chemistry 2023 Dec; 66(23):15648.
Application:WB, Human, SH-SY5Y cells.
- Spermatogonial depletion and a spermatogenesis defect in the Dp(16)1Yey mouse model of Down syndrome.
Rodolphe Dard, Anastasia Tutunaru, Malek Bouassida, Aissatu Balde Camara, Estelle Parizot, Nadim Kassis, Joanne Fortemps, Céline Cierniewski, Chrystèle Racine, Nathalie di Clemente, Francois Vialard, Nathalie Janel.
Reproduction 2023 Dec; [Epub]:0.
Application:WB, Dot blot, Mouse, Spermatogonia.
- Sex-specific developmental alterations in DYRK1A expression in the brain of a Down syndrome mouse model.
Laura E Hawley, Megan Stringer, Abigail J Deal, Andrew Folz, Charles R Goodlett, Randall J Roper.
Neurobiology of Disease 2024 Jan; 190:106359.
Application:WB, Mice, Mice brain.
- Leucettinibs, a Class of DYRK/CLK Kinase Inhibitors Inspired by the Marine Sponge Natural Product Leucettamine B.
Emmanuel Deau, Mattias F Lindberg, Frédéric Miege, Didier Roche, Nicolas George, Pascal George, Andreas Krämer, Stefan Knapp, Laurent Meijer
Journal of Medicinal Chemistry 2023 Jul; 66(15):10694.
Application:WB, Human, SH-SY5Y cells.
- Over-expression of Dyrk1A affects bleeding by modulating plasma fibronectin and fibrinogen level in mice.
Guillaume Postic, Jean Solarz, Cécile Loubière, Janany Kandiah, Jaysen Sawmynaden, Frederic Adam, Marie Vilaire, Thibaut Léger, Jean-Michel Camadro, Daniella Balduino Victorino, Marie-Claude Potier, Eric Bun, Gautier Moroy, Alexandre Kauskot, Olivier Christophe, Nathalie Janel.
Journal of Cellular and Molecular Medicine 2023 Aug; 27(15):2228.
Application:IP, WB, Human, Mouse, Human lymphoblastoid cell, Human plasma, Human platelet, Mouse platelet.
- Deficits in neuronal architecture but not over-inhibition are main determinants of reduced neuronal network activity in a mouse model of overexpression of Dyrk1A.
Linus Manubens-Gil, Meritxell Pons-Espinal, Thomas Gener, Inmaculada Ballesteros-Yañez, María Martínez de Lagrán, Mara Dierssen.
bioRxiv : the Preprint Server for Biology 2023 May; [Epub].
Application:KA, Mouse, Mouse hippocampus.
- B cell class switch recombination is regulated by DYRK1A through MSH6 phosphorylation.
Liat Stoler-Barak, Ethan Harris, Ayelet Peres, Hadas Hezroni, Mirela Kuka, Pietro Di Lucia, Amalie Grenov, Neta Gurwicz, Meital Kupervaser, Bon Ham Yip, Matteo Iannacone, Gur Yaari, John D Crispino, Ziv Shulman.
Nature Communications 2023 Mar; 14(1):1462.
Application:WB-Ti, Mouse, Mouse B cells.
- Impaired macroglial development and axonal conductivity contributes to the neuropathology of DYRK1A-related intellectual disability syndrome.
Isabel Pijuan, Elisa Balducci, Cristina Soto-Sánchez, Eduardo Fernández, María José Barallobre, Maria L Arbonés.
Scientific Reports 2022 Nov; 12(1):19912.
Application:IHC, Mouse, Mouse brain.
- Genetic Mapping of APP and Amyloid-β Biology Modulation by Trisomy 21.
Paige Mumford, Justin Tosh, Silvia Anderle, Eleni Gkanatsiou Wikberg, Gloria Lau, Sue Noy, Karen Cleverley, Takashi Saito, Takaomi C Saido, Eugene Yu, Gunnar Brinkmalm, Erik Portelius, Kaj Blennow, Henrik Zetterberg, Victor Tybulewicz, Elizabeth M C Fisher, Frances K Wiseman.
Journal of Neuroscience 2022 Aug; 42(33):6453.
Application:WB-Ce, Mouse, Mouse cortex.
- Sexually dimorphic DYRK1A overexpression on postnatal day 15 in the Ts65Dn mouse model of Down syndrome: Effects of pharmacological targeting on behavioral phenotypes.
Laura E. Hawley, Faith Prochaska, Megan Stringer, Charles R. Goodlett and Randall J. Roper.
Pharmacology, Biochemistry, and Behavior 2022 Jun; 217:173404.
Application:WB-Ti, Mouse, mouse brain.
- Fragment-Derived Selective Inhibitors of Dual-Specificity Kinases DYRK1A and DYRK1B.
David Lee Walmsley, James B Murray, Pawel Dokurno, Andrew J Massey, Karen Benwell, Andrea Fiumana, Nicolas Foloppe, Stuart Ray, Julia Smith, Allan E Surgenor, Thomas Edmonds, Didier Demarles, Mike Burbridge, Francisco Cruzalegui, Andras Kotschy, Roderick E Hubbard.
Journal of Medicinal Chemistry 2021 Jul; 64(13):8971.
Application:WB-Tr, Human, U-2 OS cells.
- A natural compound harmine decreases melanin synthesis through regulation of the DYRK1A/NFATC3 pathway.
Chi-Hyun Park, Goeun Kim, Yuri Lee, Haesoo Kim, Min Ji Song, Dong Hun Lee, Jin Ho Chung.
Journal of Dermatological Science 2021 Jul; 103(1):16.
Application:WB-Tr, Human, MNT-1 cells.
- Structure-Guided Discovery of Potent and Selective DYRK1A Inhibitors.
Csaba Weber, Melinda Sipos, Attila Paczal, Balazs Balint, Vilibald Kun, Nicolas Foloppe, Pawel Dokurno, Andrew J Massey, David Lee Walmsley, Roderick E Hubbard, James Murray, Karen Benwell, Thomas Edmonds, Didier Demarles, Alain Bruno, Mike Burbridge, Francisco Cruzalegui, Andras Kotschy.
Journal of Medicinal Chemistry 2021 May; 64(10):6745.
Application:WB-Tr, Human, U-2 OS cells.
- Protein phosphatase PPM1B inhibits DYRK1A kinase through dephosphorylation of pS258 and reduces toxic tau aggregation.
Ye Hyung Lee, Eunju Im, Minju Hyun, Joongkyu Park, Kwang Chul Chung.
The Journal of Biological Chemistry 2021 Jan; 296:100245.
Application:IP, WB-Tr, Human, Rat, H19-7, HEK 293, SH-SY5Y cells.
- Ethanol-Induced Changes in Brain of Transgenic Mice Overexpressing DYRK1A.
Marta Fructuoso, Yu Chen Gu, Nadim Kassis, Maria Martinez de Lagran, Mara Dierssen, Nathalie Janel.
Molecular Neurobiology 2020 Jul; 57(7):3195.
Application:WB-Ti, Mouse, Mouse cortex, Mouse hippocampus.
- The dual specificity kinase DYRK1A modulates the levels of cyclin L2 to control HIV replication in macrophages.
Kisaka JK, Ratner L, Kyei GB.
Journal of Virology 2020 Feb; 94(6):e01583.
Application:IF, WB-Ce, Human, 293T, HeLa cells, human monocyte-derived macrophages, Thp-1 cells.
- A comprehensive proteomics-based interaction screen that links DYRK1A to RNF169 and to the DNA damage response.
Roewenstrunk J, Di Vona C, Chen J, Borras E, Dong C, Arató K, Sabidó E, Huen MSY, de la Luna S.
Scientific Reports 2019 Apr; 9(1):6014.
Application:IF, IP, WB, Human, HeLa, U-2 OS cells.
- Inhibition of DYRK1A proteolysis modifies its kinase specificity and rescues Alzheimer phenotype in APP/PS1 mice.
Souchet B, Audrain M, Billard JM, Dairou J, Fol R, Orefice NS, Tada S, Gu Y, Dufayet-Chaffaud G, Limanton E, Carreaux F, Bazureau JP, Alves S, Meijer L, Janel N, Braudeau J, Cartier N.
Acta Neuropathologica Communications 2019 Mar; 7(1):46.
Application:IF, IHC-Fr, WB, Human, Mouse, Brains.
- Splicing Factor 3B Subunit 1 Interacts with HIV Tat and Plays a Role in Viral Transcription and Reactivation from Latency.
Kyei GB, Meng S, Ramani R, Niu A, Lagisetti C, Webb TR, Ratner L.
MBio 2018 Nov; 9(6):e01423.
Application:WB-Tr, Human, JLAT10.6 cells.
- βAPP Processing Drives Gradual Tau Pathology in an Age-Dependent Amyloid Rat Model of Alzheimer's Disease.
Audrain M, Souchet B, Alves S, Fol R, Viode A, Haddjeri A, Tada S, Orefice NS, Joséphine C, Bemelmans AP, Delzescaux T, Déglon N, Hantraye P, Akwa Y, Becher F, Billard JM, Potier B, Dutar P, Cartier N, Braudeau J.
Cerebral Cortex (New York, N.Y. : 1991) 2018 Nov; 28(11):3976.
Application:WB, Rat, Postmortem brain.
- Homocysteine-lowering gene therapy rescues signaling pathways in brain of mice with intermediate hyperhomocysteinemia.
Baloula V, Fructuoso M, Kassis N, Gueddouri D, Paul JL, Janel N.
Redox Biology 2018 Oct; 19:200.
Application:WB, Mouse, Mouse brains, livers.
- Autism-like phenotype and risk gene mRNA deadenylation by CPEB4 mis-splicing.
Parras A, Anta H, Santos-Galindo M, Swarup V, Elorza A, Nieto-González JL, Picó S, Hernández IH, Díaz-Hernández JI, Belloc E, Rodolosse A, Parikshak NN, Peñagarikano O, Fernández-Chacón R, Irimia M, Navarro P, Geschwind DH, Méndez R, Lucas JJ.
Nature 2018 Aug; 560(7719):441.
Application:WB-Ti, Human, Cortex.
- LPS-Induced Inflammation Abolishes the Effect of DYRK1A on IkB Stability in the Brain of Mice.
Latour A, Gu Y, Kassis N, Daubigney F, Colin C, Gausserès B, Middendorp S, Paul JL, Hindié V, Rain JC, Delabar JM, Yu E, Arbones M, Mallat M, Janel N.
Molecular Neurobiology 2018 May; [Epub].
Application:IP-WB, Mouse, Brain.
- Cerebellar alterations in a model of Down syndrome: The role of the Dyrk1A gene.
García-Cerro S, Vidal V, Lantigua S, Berciano MT, Lafarga M, Ramos-Cabrer P, Padro D, Rueda N, Martínez-Cué C.
Neurobiology of Disease 2017 Dec; 110:206.
Application:WB-Ti, Mouse, Mouse brain.
- A Requirement for Mena, an Actin Regulator, in Local mRNA Translation in Developing Neurons.
Marina Vidaki, Frauke Drees, Tanvi Saxena, Erwin Lanslots, Matthew J Taliaferro, Antonios Tatarakis, Christopher B Burge, Eric T Wang, Frank B Gertler.
Neuron 2017 Jul; 95(3):608.
Application:WB-Ce, WB-Ti, Mouse , Mouse brain, Mouse primary neuron.
- Combined assessment of DYRK1A, BDNF and homocysteine levels as diagnostic marker for Alzheimer's disease.
Janel N, Alexopoulos P, Badel A, Lamari F, Camproux AC, Lagarde J, Simon S, Feraudet-Tarisse C, Lamourette P, Arbones M, Paul JL, Dubois B, Potier MC, Sarazin M, Delabar JM.
Translational Psychiatry 2017 Jun; 7(6):e1154.
Application:WB-Ti, Mouse, Mouse embryos.
- Overexpression of the DYRK1A Gene (Dual-Specificity Tyrosine Phosphorylation-Regulated Kinase 1A) Induces Alterations of the Serotoninergic and Dopaminergic Processing in Murine Brain Tissues.
London J, Rouch C, Bui LC, Assayag E, Souchet B, Daubigney F, Medjaoui H, Luquet S, Magnan C, Delabar JM, Dairou J, Janel N.
Molecular Neurobiology 2018 May; 55(5):3822.
Application:WB-Ti, Mouse, Mouse brain.
- Altered regulation of the Spry2/Dyrk1A/PP2A triad by homocysteine impairs neural progenitor cell proliferation.
Rabaneda LG, Geribaldi-Doldán N, Murillo-Carretero M, Carrasco M, Martínez-Salas JM, Verástegui C, Castro C.
Biochimica et Biophysica Acta 2016 Sep; 1863(12):3015.
Application:WB, Mouse, Mouse hippocampus.
- The adaptor protein DCAF7 mediates the interaction of the adenovirus E1A oncoprotein with the protein kinases DYRK1A and HIPK2.
Glenewinkel F, Cohen MJ, King CR, Kaspar S, Bamberg-Lemper S, Mymryk JS, Becker W.
Scientific Reports 2016 Jun; 6:28241.
Application:IP-WB, WB-Tr, Human, HeLa, HT1080 cells.
- DYRK1A overexpression enhances STAT activity and astrogliogenesis in a Down syndrome mouse model.
Kurabayashi N, Nguyen MD, Sanada K.
EMBO Reports 2015 Nov; 16(11):1548.
Application:IF, Mouse, Neocortical cells.
- Low dose EGCG treatment beginning in adolescence does not improve cognitive impairment in a Down syndrome mouse model.
Stringer M, Abeysekera I, Dria KJ, Roper RJ, Goodlett CR.
Pharmacology, Biochemistry, and Behavior 2015 Nov; 138:70.
Application:IP, Mouse, Hippocampus, Cerebellum.
- Rescue of the abnormal skeletal phenotype in Ts65Dn Down syndrome mice using genetic and therapeutic modulation of trisomic Dyrk1a.
Joshua D. Blazek, Irushi Abeysekera, Jiliang Li and Randall J. Roper.
Human Molecular Genetics 2015 Oct; 24(20):5687.
Application:IP, Mouse, Femur.
- DYRK1A controls the transition from proliferation to quiescence during lymphoid development by destabilizing Cyclin D3.
Thompson BJ, Bhansali R, Diebold L, Cook DE, Stolzenburg L, Casagrande AS, Besson T, Leblond B, Desire L, Malinge S, Crispino JD.
The Journal of Experimental Medicine 2015 Jun; 12(6):953.
Application:WB-Ti, Mouse, Bone marrow, Thymus.
- Chromatin-wide profiling of DYRK1A reveals a role as a gene-specific RNA polymerase II CTD kinase.
Chiara Di Vona, Daniela Bezdan, Abul B M M K Islam, Eulàlia Salichs, Nuria López-Bigas, Stephan Ossowski, Susana de la Luna.
Molecular Cell 2015 Feb; 57(3):506.
Application:Electrophoresis, IP, Human, HeLa cells.
- DYRK1A-mediated Cyclin D1 Degradation in Neural Stem Cells Contributes to the Neurogenic Cortical Defects in Down Syndrome.
Najas S, Arranz J, Lochhead PA, Ashford AL, Oxley D, Delabar JM, Cook SJ, Barallobre MJ, Arbones ML.
EBioMedicine 2015 Jan; 2(2):120.
Application:WB, Mouse, Embryos.
- Corrective effects of hepatotoxicity by hepatic Dyrk1a gene delivery in mice with intermediate hyperhomocysteinemia.
Latour A, Salameh S, Carbonne C, Daubigney F, Paul JL, Kergoat M, Autier V, Delabar JM, De Geest B, Janel N.
Molecular Genetics and Metabolism Reports 2015 Jan; 2:51.
Application:WB-Ti, Mouse, Liver.
- One-carbon cycle alterations induced by Dyrk1a dosage.
Delabar JM, Latour A, Noll C, Renon M, Salameh S, Paul JL, Arbones M, Movassat J, Janel N.
Molecular Genetics and Metabolism Reports 2014 Nov; 1:487.
Application:Slot blot, Mouse, Rat, Liver.
- DYRK1A-mediated phosphorylation of GluN2A at Ser1048 regulates the surface expression and channel activity of GluN1/GluN2A receptors.
Grau C, Arato K, Fernández-Fernandez JM, Valderrama A, Sindreu C, Fillat C, Ferrer I, de la Luna S, Altafaj X.
Frontiers in Cellular Neuroscience 2014 Oct; 8:331.
Application:IP, Mouse, Brain.
- Overexpression of Dyrk1A Is Implicated in Several Cognitive, Electrophysiological and Neuromorphological Alterations Found in a Mouse Model of Down Syndrome.
Garcia-Cerro S, Martinez P, Vidal V, Corrales A, Florez J, Vidal R, Rueda N, Arbones ML, Martinez-Cue C.
PLoS One 2015 Sep; 9(9):e106572.
Application:WB-Ti, Mouse, Hippocampus.
- Plasma DYRK1A as a novel risk factor for Alzheimer's disease.
Janel N, Sarazin M, Corlier F, Corne H, de Souza LC, Hamelin L, Aka A, Lagarde J, Blehaut H, Hindie V, Rain JC, Arbones ML, Dubois B, Potier MC, Bottlaender M, Delabar JM.
Translational Psychiatry 2014 Aug; 4:e425.
Application:WB, Human, Mouse, Brain, plasma.
- Molecular Rescue of DYRK1A Overexpression in Cystathionine Beta Synthase-Deficient Mouse Brain by Enriched Environment Combined with Voluntary Exercise.
Souchet B, Latour A, Gu Y, Daubigney F, Paul JL, Delabar JM, Janel N.
Journal of Molecular Neuroscience 2015 Feb; 55(2):318.
Application:WB-Ti, Mouse, Brain.
- Dyrk1a haploinsufficiency induces diabetes in mice through decreased pancreatic beta cell mass.
Rachdi L, Kariyawasam D, Guez F, Aiello V, Arbones ML, Janel N, Delabar JM, Polak M, Scharfmann R.
Diabetologia 2014 May; 57(5):960.
Application:WB-Ti, Mouse, Pancreas, Islets.
- Prefrontal deficits in a murine model overexpressing the down syndrome candidate gene dyrk1a.
Thomazeau A, Lassalle O, Iafrati J, Souchet B, Guedj F, Janel N, Chavis P, Delabar J, Manzoni OJ.
The Journal of Neuroscience 2014 Jan; 34(4):1138.
Application:WB-Tr, Mouse, ES cells.
- Modelling and rescuing neurodevelopmental defect of Down syndrome using induced pluripotent stem cells from monozygotic twins discordant for trisomy 21.
Hibaoui Y, Grad I, Letourneau A, Sailani MR, Dahoun S, Santoni FA, Gimelli S, Guipponi M, Pelte MF, Bena F, Antonarakis SE, Feki A.
EMBO Molecular Medicine 2014 Feb; 6(2):259.
Application:KA, WB-Tr, Human, Neural progenitor cells.
- CLK/DYRK Kinases Inhibitor Leucettine L41 Induces Mtor-dependent Autophagy. Implication for Alzheimers' Disease.
Fant X, Durieu E, Chicanne G, Payrastre B, Sbrissa D, Shisheva A, Limanton E, Carreaux F, Bazureau JP, Meijer L.
Molecular Pharmacology 2014 Mar; 85(3):441.
Application:WB, Human, Mouse, HT22, U-2 OS cells.
- Environmental enrichment rescues DYRK1A activity and hippocampal adult neurogenesis in TgDyrk1A.
Pons-Espinal M, Martinez de Lagran M, Dierssen M.
Neurobiology of Disease 2013 Dec; 60:18.
Application:IF, IP, Mouse, Brain, Hippocampus.
- NGF Upregulates the Plasminogen Activation Inhibitor-1 in Neurons via the Calcineurin/NFAT Pathway and the Down Syndrome-Related Proteins DYRK1A and RCAN1 Attenuate This Effect.
Stefos GC, Soppa U, Dierssen M, Becker W.
PLoS One 2013 Jun; 8(6):e67470.
Application:WB-Tr, Rat, PC-12 cells.
- Triplication of DYRK1A causes retinal structural and functional alterations in Down syndrome.
Laguna A, Barallobre MJ, Marchena MA, Mateus C, Ramirez E, Martinez-Cue C, Delabar JM, Castelo-Branco M, de la Villa P, Arbones ML.
Human Molecular Genetics 2013 Jul; 22(14):2775.
Application:WB, Mouse, Retina.
- Hepatocyte-specific Dyrk1a gene transfer rescues plasma apolipoprotein A-I levels and aortic Akt/GSK3 pathways in hyperhomocysteinemic mice.
Tlili A, Jacobs F, de Koning L, Mohamed S, Bui LC, Dairou J, Belin N, Ducros V, Dubois T, Paul JL, Delabar JM, De Geest B, Janel N.
Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease 2013 Jun; 1832(6):718.
Application:WB, Mouse, Liver.
- Dyrk1A Is Dynamically Expressed on Subsets of Motor Neurons and in the Neuromuscular Junction: Possible Role in Down Syndrome.
Arque G, Casanovas A, Dierssen M.
PLoS One 2013 Jan; 8(1):e54285.
Application:IF, IHC-Fr, Mouse, Coronal sections, spinal cord, neuromuscular synapses.
- Normalization of Dyrk1A expression by AAV2/1-shDyrk1A attenuates hippocampal-dependent defects in the Ts65Dn mouse model of Down syndrome.
Altafaj X, Martín ED, Ortiz-Abalia J, Valderrama A, Lao-Peregrín C, Dierssen M, Fillat C.
Neurobiology of Disease 2013 Apr; 52:117.
Application:IHC-P, Mouse, Brain.
- Expression of trisomic proteins in Down syndrome model systems.
Spellman C, Ahmed MM, Dubach D, Gardiner KJ.
Gene 2013 Jan; 12(2):219.
Application:WB-Ce, Human, Mouse, Lymphoblastoid cells, mouse cortex.
- The NAD(+)-dependent protein deacetylase activity of SIRT1 is regulated by its oligomeric status.
Guo X, Kesimer M, Tolun G, Zheng X, Xu Q, Lu J, Sheehan JK, Griffith JD, Li X.
Scientific Reports 2012 Sep; 2:640.
Application:Func, Recombinant protein.
- Dyrk1A, a serine/threonine kinase, is involved in ERK and Akt activation in the brain of hyperhomocysteinemic mice.
Abekhoukh S, Planque C, Ripoll C, Urbaniak P, Paul JL, Delabar JM, Janel N.
Molecular Neurobiology 2013 Feb; 47(1):105.
Application:WB-Ti, Mouse, Mouse brain.
- Mice deficient in cystathionine beta synthase display increased Dyrk1A and SAHH activities in brain.
Planque C, Dairou J, Noll C, Bui LC, Ripoll C, Guedj F, Delabar JM, Janel N.
Journal of Molecular Neuroscience 2013 May; 50(1):1.
Application:WB-Ti, Mouse, Mouse brain.
- Increased dosage of the chromosome 21 ortholog Dyrk1a promotes megakaryoblastic leukemia in a murine model of Down syndrome.
Malinge S, Bliss-Moreau M, Kirsammer G, Diebold L, Chlon T, Gurbuxani S, Crispino JD.
The Journal of Clinical Investigation 2012 Mar; 122(3):948.
Application:WB-Ce, Mouse, Megakaryocytes.
- DYRK1A: A master regulatory protein controlling brain growth.
Guedj F, Pereira PL, Najas S, Barallobre MJ, Chabert C, Souchet B, Sebrie C, Verney C, Herault Y, Arbones M, Delabar JM.
Neurobiology of Disease 2012 Jan; 46(1):190.
Application:WB-Ti, Mouse, Mouse hippocampus.
- Loss of correlations among proteins in brains of the Ts65Dn mouse model of down syndrome.
Ahmed MM, Sturgeon X, Ellison M, Davisson MT, Gardiner KJ.
Journal of Proteome Research 2012 Feb; 11(2):1251.
Application:WB-Ti, Mouse, Mouse brains.
- Dyrk1A negatively regulates the actin cytoskeleton through threonine phosphorylation of N-WASP.
Park J, Sung JY, Park J, Song WJ, Chang S, Chung KC.
Journal of Cell Science 2012 Jan; 125(Pt1):67.
Application:IP-WB, WB, Human, Rat, HEK293, Rat brain.
- Altered regulation of tau phosphorylation in a mouse model of down syndrome aging.
Sheppard O, Plattner F, Rubin A, Slender A, Linehan JM, Brandner S, Tybulewicz VL, Fisher EM, Wiseman FK.
Neurobiology of Aging 2012 Apr; 33(4):828.e31.
Application:WB-Ti, Mouse, Cortex, Hippocampus.
- Engineering DYRK1A over-dosage yields Down syndrome-characteristic cortical splicing aberrations.
Toiber D, Azkona G, Ben-Ari S, Toran N, Soreq H, Dierssen M.
Neurobiology of Disease 2010 Oct; 40(1):348.
Application:WB-Ti, Human, Mouse, Brains.
- DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
Guo X, Williams JG, Schug TT, Li X.
The Journal of Biological Chemistry 2010 Apr; 285(17):13223.
Application:IF, WB-Ce, WB-Tr, Human, Mouse, HEK 293T cells, MEFs, U-2 OS cells.
- Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats.
Raaf L, Noll C, Cherifi M, Benazzoug Y, Delabar JM, Janel N.
International Journal of Cardiology 2010 Nov; 145(2):306.
Application:WB-Ti, Rat, Rat hearts.
- DYRK1A, a Novel Determinant of the Methionine-Homocysteine Cycle in Different Mouse Models Overexpressing this Down-Syndrome-Associated Kinase.
Noll C, Planque C, Ripoll C, Guedj F, Diez A, Ducros V, Belin N, Duchon A, Paul JL, Badel A, de Freminville B, Grattau Y, Blehaut H, Herault Y, Janel N, Delabar JM.
PLoS One 2009 Oct; 4(10):e7540.
Application:WB-Ti, Mouse, Mouse liver.
- Negative Feedback Inhibition of NFATc1 by DYRK1A Regulates Bone Homeostasis.
Lee Y, Ha J, Kim HJ, Kim YS, Chang EJ, Song WJ, Kim HH.
The Journal of Biological Chemistry 2009 Oct; 284(48):33343.
Application:WB-Tr, Human, Mouse, Human 293FT cells, Mouse bone marrow macrophages.
- Nonprimed and DYRK1A-primed GSK3?]-phosphorylation sites on MAP1B regulate microtubule dynamics in growing axons.
Scales TM, Lin S, Kraus M, Goold RG, Gordon-Weeks PR.
Journal of Cell Science 2009 Jul; 122(Pt 14):2424.
Application:WB-Tr, Rat, Rat cortical neurons.
- Green Tea Polyphenols Rescue of Brain Defects Induced by Overexpression of DYRK1A.
Guedj F, Sebrie C, Rivals I, Ledru A, Paly E, Bizot JC, Smith D, Rubin E, Gillet B, Arbones M, Delabar JM.
PLoS One 2009 Feb; 4(2):e4606.
Application:WB-Ti, Mouse, Mouse brain.
- Effect of hyperhomocysteinemia on the protein kinase DYRK1A in liver of mice.
Hamelet J, Noll C, Ripoll C, Paul JL, Janel N, Delabar JM.
Biochemical and Biophysical Research Communications 2008 Dec; 378(3):673.
Application:WB, Mouse, Liver of CBS-deficient mice, primary hepatocytes/Kupffer cells.
- Sprouty2 inhibitory activity on FGF-signaling is modulated by the protein kinase DYRK1A.
Aranda S, Alvarez M, Turro S, Laguna A, de la Luna S.
Molecular and Cellular Biology 2008 Aug; 28(19):5899.
Application:IF, IP-WB, Human, Mouse, HEK 293 cells, Mouse brain.
- Prenatal treatment with preimplantation factor improves early postnatal neurogenesis and cognitive impairments in a mouse model of Down syndrome.
DYRK1A monoclonal antibody (M01), clone 7D10
Katalog-Nummer H00001859-M01
Size : 100ug
Marke : Abnova
Images