FAH antibody - C-terminal region
Katalog-Nummer ARP41681_T100
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-FAH (ARP41681_T100) antibody |
---|
Publications | Functional and Biochemical Characterization of Hepatitis C Virus (HCV) Particles Produced in a Humanized Liver Mouse Model. J. Biol. Chem. 290, 23173-87 (2015). 262246331-28 (2014). 244652771$s> |
---|---|
Tested Species Reactivity | Human, Mouse |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Additional Information | IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE) |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAH |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-FAH (ARP41681_T100) antibody is Catalog # AAP41681 (Previous Catalog # AAPP24324) |
Other Applications Image 1 Data | Sample Type: Human Liver and Mouse FAH KO liver Primary Dilution: 1:400 |
Reference | Bliksrud,Y.T., (2005) J. Mol. Med. 83 (5), 406-410 |
---|---|
Gene Symbol | FAH |
Gene Full Name | Fumarylacetoacetate hydrolase (fumarylacetoacetase) |
NCBI Gene Id | 2184 |
Protein Name | Fumarylacetoacetase |
Description of Target | FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). |
Uniprot ID | P16930 |
Protein Accession # | NP_000128 |
Nucleotide Accession # | NM_000137 |
Protein Size (# AA) | 419 |
Molecular Weight | 46kDa |
Protein Interactions | KRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR; |