- Specifications
Product Description
Human MSH6 partial ORF ( NP_000170, 931 a.a. - 1030 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — MSH6
Entrez GeneID
2956GeneBank Accession#
NM_000179Protein Accession#
NP_000170Gene Name
MSH6
Gene Alias
GTBP, HNPCC5, HSAP
Gene Description
mutS homolog 6 (E. coli)
Omim ID
600678Gene Ontology
HyperlinkGene Summary
This gene encodes a protein similar to the MutS protein. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides, prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein of this gene combines with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene have been identified in individuals with hereditary nonpolyposis colon cancer (HNPCC) and endometrial cancer. [provided by RefSeq
Other Designations
G/T mismatch-binding protein|mutS homolog 6|sperm-associated protein
- Interactomes
- Pathways
- Diseases
MSH6 (Human) Recombinant Protein (Q01)
Katalog-Nummer H00002956-Q01
Size : 10ug
Marke : Abnova
Images