ATP5B antibody - N-terminal region
Cat# ARP48185_T100
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-ATP5F1B (ARP48185_T100) antibody |
---|
Publications | A Chinese herbal formula, Jian-Pi-Yi-Shen decoction, improves muscle atrophy via regulating mitochondrial quality control process in 5/6 nephrectomised rats. Sci Rep. 7, 9253 (2017). 28835671 Antioxidant Apigenin Relieves Age-Related Muscle Atrophy by Inhibiting Oxidative Stress and Hyperactive Mitophagy and Apoptosis in Skeletal Muscle of Mice. J Gerontol A Biol Sci Med Sci. 75, 2081-2088 (2020). 32857105 Bannister, J. P. et al. Ca(V)1.2 channel N-terminal splice variants modulate functional surface expression in resistance size artery smooth muscle cells. J. Biol. Chem. 286, 15058-66 (2011). 21364284 Guo, J. et al. Protein targets for carbonylation by 4-hydroxy-2-nonenal in rat liver mitochondria. J. Proteomics 74, 2370-9 (2011). 21801862 Li, N., Bates, D. J., An, J., Terry, D. A. & Wang, E. Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain. Neurobiol. Aging 32, 944-55 (2011). 19487051 Resveratrol Improves Muscle Atrophy by Modulating Mitochondrial Quality Control in STZ-Induced Diabetic Mice. Mol Nutr Food Res. 62, e1700941 (2018). 29578301 | ||
---|---|---|---|
Tested Species Reactivity | Human, Mouse, Rat | ||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | IHC, WB | ||
Additional Information | IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B | ||
Purification | Protein A purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93% | ||
Peptide Sequence | Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ | ||
Concentration | 1.0 mg/ml | ||
Blocking Peptide | For anti-ATP5F1B (ARP48185_T100) antibody is Catalog # AAP48185 (Previous Catalog # AAPP28694) | ||
Subunit | beta, mitochondrial | ||
Enhanced Validation |
|
Reference | Vantourout,P., (2008) Mol. Immunol. 45 (2), 485-492 |
---|---|
Gene Symbol | ATP5F1B |
Gene Full Name | ATP synthase F1 subunit beta |
Alias Symbols | ATP5B, ATPMB, ATPSB, HEL-S-271 |
NCBI Gene Id | 506 |
Protein Name | ATP synthase subunit beta, mitochondrial |
Description of Target | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. |
Uniprot ID | P06576 |
Protein Accession # | NP_001677 |
Nucleotide Accession # | NM_001686 |
Protein Size (# AA) | 529 |
Molecular Weight | 57 kDa |
Protein Interactions | FUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT |
-
What is the species homology for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish".
-
How long will it take to receive "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ATP5F1B Antibody - N-terminal region (ARP48185_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
This target may also be called "ATP5B, ATPMB, ATPSB, HEL-S-271" in publications.
-
What is the shipping cost for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "57 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ATP5F1B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ATP5F1B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ATP5F1B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ATP5F1B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ATP5F1B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ATP5F1B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.