- More Files
- Specification
Product Description
Human CPNE4 partial ORF ( NP_570720, 11 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEAD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — CPNE4
Entrez GeneID
131034GeneBank Accession#
NM_130808Protein Accession#
NP_570720Gene Name
CPNE4
Gene Alias
COPN4, CPN4, MGC15604
Gene Description
copine IV
Omim ID
604208Gene Ontology
HyperlinkGene Summary
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. [provided by RefSeq
Other Designations
copine 8
- Interactome
- Disease