DPPA2 (Developmental Pluripotency-associated Protein 2, Pluripotent Embryonic Stem Cell-related Gene 1 Protein, PESCRG1)
Cat# 126002-50ug
Size : 50ug
Brand : US Biological
126002 DPPA2 (Developmental Pluripotency-associated Protein 2, Pluripotent Embryonic Stem Cell-related Gene 1 Protein, PESCRG1)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
BC018070, AAH18070.1Shipping Temp
Blue IceStorage Temp
-20°CDPPA2 may play a role in maintaining cell pluripotentiality.||Applications:|Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.