TBX21 Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 58 kDa |
Gene Name | T-box 21 |
Database Link | |
Background | Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs. |
Synonyms | T-bet; T-PET; TBET; TBLYM |
Note | Immunogen Sequence Homology: Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Sheep: 86%; Bovine: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
|
SDS |
Resources
Antibody Resources |
|