UBR3 Antibody : HRP
Cat# ARP43449_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
UBR3 Antibody - C-terminal region (ARP43449_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-UBR3 (ARP43449_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBR3 |
Purification | Affinity purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-UBR3 (ARP43449_P050) antibody is Catalog # AAP43449 |
Gene Symbol | UBR3 |
---|---|
Gene Full Name | ubiquitin protein ligase E3 component n-recognin 3 (putative) |
Alias Symbols | ZNF650 |
NCBI Gene Id | 130507 |
Protein Name | E3 ubiquitin-protein ligase UBR3 |
Description of Target | E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. |
Uniprot ID | Q6ZT12-3 |
Protein Size (# AA) | 43 |
Molecular Weight | 394 |
Protein Interactions | DZIP3; UBC; UBE2Z; UBE2B; UBE2A; |