Specifications

Product Data
Applications	WB
Recommended Dilution	WB
Reactivities	Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-AHNAK2 antibody: synthetic peptide directed towards the middle region of human AHNAK2. Synthetic peptide located within the following region: AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	85 kDa
Gene Name	AHNAK nucleoprotein 2
Database Link	NP_612429 Entrez Gene 113146 Human UniProt ID Q8IVF2
Background	The specific function of AHNAK2 is not yet known.
Synonyms	C14orf78
Note	Immunogen sequence homology: Human: 100%; Yeast: 83%
Reference Data