ALDOB Antibody - N-terminal region : HRP
Cat# ARP41364_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
ALDOB Antibody - N-terminal region (ARP41364_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-ALDOB (ARP41364_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDOB |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 90%; Zebrafish: 75% |
Peptide Sequence | Synthetic peptide located within the following region: ADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ALDOB (ARP41364_P050) antibody is Catalog # AAP41364 |
Gene Symbol | ALDOB |
---|---|
Gene Full Name | aldolase B, fructose-bisphosphate |
Alias Symbols | ALDB, ALDO2 |
NCBI Gene Id | 229 |
Protein Name | Fructose-bisphosphate aldolase B |
Description of Target | Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. |
Uniprot ID | P05062 |
Protein Accession # | NP_000026 |
Protein Size (# AA) | 364 |
Molecular Weight | 40kDa |
Protein Interactions | BBS7; BBS4; BBS2; BBS1; MUC20; AGXT2; TXN2; UBC; HIVEP1; ALDOA; APP; HSPA8; ALDOB; ATP6V1E1; |