C3orf67 antibody - N-terminal region
Cat# ARP50865_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
C3orf67 Antibody - N-terminal region (ARP50865_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for ARP50865_P050 |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C3orf67 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: TDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAESDQFINRG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | Catalog # AAP50865 (Previous Catalog # AAPs30302) |
| Gene Symbol | C3orf67 |
|---|---|
| Gene Full Name | Chromosome 3 open reading frame 67 |
| Alias Symbols | C3orf67 |
| NCBI Gene Id | 200844 |
| Protein Name | Uncharacterized protein C3orf67 |
| Description of Target | The function of the protein remains unknown. |
| Uniprot ID | Q6ZVT6 |
| Protein Accession # | NP_940865 |
| Nucleotide Accession # | NM_198463 |
| Protein Size (# AA) | 563 |
| Molecular Weight | 63kDa |