CD34 antibody - C-terminal region
Cat# ARP60993_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
CD34 Antibody - C-terminal region (ARP60993_P050)
| Datasheets/Manuals | Printable datasheet for anti-CD34 (ARP60993_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Goat, Guinea Pig, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD34 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CD34 (ARP60993_P050) antibody is Catalog # AAP60993 (Previous Catalog # AAPP47131) |
| Gene Symbol | CD34 |
|---|---|
| Gene Full Name | CD34 molecule |
| Alias Symbols | - |
| NCBI Gene Id | 947 |
| Protein Name | CD34 antigen EMBL BAE46748.1 |
| Description of Target | CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells. |
| Uniprot ID | Q3C1E7 |
| Protein Accession # | NP_001764 |
| Nucleotide Accession # | NM_001773 |
| Protein Size (# AA) | 328 |
| Molecular Weight | 35kDa |
| Protein Interactions | CHST4; CRKL; PRKCD; ATF5; CREM; |
