- More Files
Western Blot (Transfected lysate)
Western Blot analysis of NEUROD1 expression in transfected 293T cell line by NEUROD1 monoclonal antibody (M01), clone 3H8.
Lane 1: NEUROD1 transfected lysate(39.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEUROD1 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEUROD1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEUROD1.
Immunogen
NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Transfected lysate)
Western Blot analysis of NEUROD1 expression in transfected 293T cell line by NEUROD1 monoclonal antibody (M01), clone 3H8.
Lane 1: NEUROD1 transfected lysate(39.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEUROD1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEUROD1 on HeLa cell. [antibody concentration 10 ug/ml] - Gene Info — NEUROD1
Entrez GeneID
4760GeneBank Accession#
BC009046Protein Accession#
AAH09046Gene Name
NEUROD1
Gene Alias
BETA2, BHF-1, NEUROD, bHLHa3
Gene Description
neurogenic differentiation 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. [provided by RefSeq
Other Designations
basic helix-loop-helix transcription factor|beta-cell E-box transactivator 2|neurogenic differentiation factor 1|neurogenic helix-loop-helix protein NEUROD
- Interactomes
- Pathways
- Diseases
- Publication Reference
- Neuroendocrine Key Regulator Gene Expression in Merkel Cell Carcinoma.
Chteinberg E, Sauer CM, Rennspiess D, Beumers L, Schiffelers L, Eben J, Haugg A, Winnepenninckx V, Kurz AK, Speel EJ, Zenke M, Zur Hausen A.
Neoplasia 2018 Dec; 20(12):1227.
Application：IHC, Human, MKL-1, MKL-2, WaGa, MCC13, MCC26, REH cells.
- Neuroendocrine carcinoma of the esophagus: clinicopathologic study of 10 cases and verification of the diagnostic utility of mASH1, NeuroD1, and PGP9.5.
Akazawa M, Kawachi H, Kitagaki K, Seki T, Kawaragi S, Yuzawa M, Sekine M, Kobayashi M, Nakajima Y, Kawano T, Eishi Y.
Esophagus 2014 Sep; 11(4):245.
Application：IHC, Human, Esophageal tumors.
- Neuroendocrine Key Regulator Gene Expression in Merkel Cell Carcinoma.