RAB2B antibody - C-terminal region

Cat# ARP60690_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-RAB2B (ARP60690_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human RAB2B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Human: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS
Concentration0.5 mg/ml
Blocking PeptideFor anti-RAB2B (ARP60690_P050) antibody is Catalog # AAP60690 (Previous Catalog # AAPP46841)
Gene SymbolRAB2B
Gene Full NameRAB2B, member RAS oncogene family
Alias SymbolsFLJ14824
NCBI Gene Id84932
Protein NameRas-related protein Rab-2B
Description of TargetMembers of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking.
Uniprot IDQ8WUD1
Protein Accession #NP_116235
Nucleotide Accession #NM_032846
Protein Size (# AA)216
Molecular Weight24kDa
Protein InteractionsFAM71C; FAM114A1; ADAMTSL4; BLZF1; ICA1; GOLGA2; BAG3; UBC; ATF2; APP; ELAVL1; SMAD1; SMAD4;
  1. What is the species homology for "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Pig".

  2. How long will it take to receive "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RAB2B Antibody - C-terminal region (ARP60690_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    This target may also be called "FLJ14824" in publications.

  5. What is the shipping cost for "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RAB2B Antibody - C-terminal region (ARP60690_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RAB2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RAB2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RAB2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RAB2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RAB2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RAB2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
ARP40975_P050
 100ul 
ARP40463_P050
 100ul 
ARP45401_P050
 100ul