Recombinant Mouse Small proline-rich protein 2A1 (Sprr2a1) - E.coli
Cat# CSB-EP022612MO-20ug
Size : 20ug
Brand : Cusabio
Contact local distributor :
Phone : +1 850 650 7790
Recombinant Mouse Small proline-rich protein 2A1 (Sprr2a1)
In Stock| Code | CSB-EP022612MO |
| MSDS | |
| Image | |
Product Details
Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Sprr2a1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Sprr2a1; Sprr2a; Small proline-rich protein 2A1; small proline-rich protein 2A
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-83aa
Target Protein Sequence
MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
13.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant mouse small proline-rich protein 2A1 (Sprr2a1) production in E. coli involves co-inserting the gene of interest (1-83aa of mouse Sprr2a1) into an expression vector with an N-terminal 6xHis-tag gene and transforming it into E. coli cells. The cells are cultured under conditions that induce protein expression. After sufficient growth, the cells are lysed to release the recombinant Sprr2a1 protein. The obtained recombinant Sprr2a1 protein is purified through the affinity chromatography technique. The purity of the Sprr2a1 protein is assessed using SDS-PAGE, exceeding 90%.
SP...
Customer Reviews and Q&A
■ Customer Reviews
There are currently no reviews for this product.
Target Background
Function
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Subcellular Location
Cytoplasm.
Protein Families
Cornifin (SPRR) family
Database Links
KEGG:
UniGene:
