SOX21 Rabbit Polyclonal Antibody

Cat# TA329317

Size : 100ul

Request more information

Contact local distributor :


Phone :

SOX21 Rabbit Polyclonal Antibody

Specifications
Product Data
Application WB
Application WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SOX21 antibody: synthetic peptide directed towards the middle region of human SOX21. Synthetic peptide located within the following region: EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name SRY-box 21
Database Link
Background SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148). [supplied by OMIM, Apr 2004]
Synonyms SOX25
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 86%
Reference Data
Write Your Own Review
You're reviewing:SOX21 Rabbit Polyclonal Antibody
Your Rating
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
6160-08
 1.0mg 
6160-05
 1.0mL