TEAD4 Antibody - C-terminal region

Cat# ARP38276_P050-25UL

Size : 25ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

TEAD4 Antibody - C-terminal region (ARP38276_P050)

Datasheets/ManualsPrintable datasheet for anti-TEAD4 (ARP38276_P050) antibody
Product Info
Publications

Identification of Quinolinols as Activators of TEAD-Dependent Transcription. ACS Chem Biol. 14, 2909-2921 (2019). 31742995

Ribas, R. et al. Members of the TEAD family of transcription factors regulate the expression of Myf5 in ventral somitic compartments. Dev. Biol. 355, 372-80 (2011). 21527258

Screening with a novel cell-based assay for TAZ activators identifies a compound that enhances myogenesis in C2C12 cells and facilitates muscle repair in a muscle injury model. Mol Cell Biol. 34, 1607-21 (2014). 24550007

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TEAD4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TEAD4 (ARP38276_P050) antibody is Catalog # AAP38276 (Previous Catalog # AAPP20485)
Sample Type Confirmation

TEAD4 is supported by BioGPS gene expression data to be expressed in HEK293T

Enhanced Validation
WBY
SPRY
YCHAROS
ReferenceChen,H.H., et al., (2004) Circulation 110 (19), 2980-2987
Gene SymbolTEAD4
Gene Full NameTEA domain family member 4
Alias SymbolsTEF3, RTEF1, TEF-3, EFTR-2, TEFR-1, TCF13L1, hRTEF-1B
NCBI Gene Id7004
Protein NameTranscriptional enhancer factor TEF-3
Description of TargetTEAD4 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. TEAD4 is encoded through the use of a non-AUG (TTG) translation initiation codon. This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. The protein is encoded through the use of a non-AUG (TTG) translation initiation codon. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Uniprot IDQ96BK2
Protein Accession #NP_003204
Nucleotide Accession #NM_003213
Protein Size (# AA)434
Molecular Weight48kDa
Protein InteractionsCCDC172; SSX2IP; LZTS2; CEP70; CEP55; RABGEF1; CCNDBP1; KIAA0753; PNMA1; TRAF1; VPS52; TRIM27; GOLGA2; UBC; SUMO2; CCDC85B; WWTR1; YAP1; VGLL1; MYH7;