DDX46 Antibody - middle region : FITC

Cat# ARP36424_P050-FITC

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-DDX46 (ARP36424_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DDX46
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV
Concentration0.5 mg/ml
Blocking PeptideFor anti-DDX46 (ARP36424_P050) antibody is Catalog # AAP36424 (Previous Catalog # AAPS07109)
Sample Type Confirmation

DDX46 is supported by BioGPS gene expression data to be expressed in MCF7

ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolDDX46
Gene Full NameDEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Alias SymbolsPrp5, PRPF5
NCBI Gene Id9879
Protein NameProbable ATP-dependent RNA helicase DDX46
Description of TargetDDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing. This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.
Uniprot IDQ7L014
Protein Accession #NP_055644
Nucleotide Accession #NM_014829
Protein Size (# AA)1031
Molecular Weight117kDa
Protein InteractionsHUWE1; UBC; RPA3; RPA2; RPA1; PRPF40A; APBB1; SRPK2; LMNA; TPM2; PNLIPRP2; SMIM20; GEMIN5; SF3A3; SRSF11; CUL3; SIRT7; SF3A2; ELAVL1; SUMO2; Sf3a1; TCEA1;
  1. What is the species homology for "DDX46 Antibody - middle region (ARP36424_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "DDX46 Antibody - middle region (ARP36424_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DDX46 Antibody - middle region (ARP36424_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DDX46 Antibody - middle region (ARP36424_P050)"?

    This target may also be called "Prp5, PRPF5" in publications.

  5. What is the shipping cost for "DDX46 Antibody - middle region (ARP36424_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "DDX46 Antibody - middle region (ARP36424_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DDX46 Antibody - middle region (ARP36424_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "117kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DDX46 Antibody - middle region (ARP36424_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DDX46"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DDX46"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DDX46"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DDX46"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DDX46"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DDX46"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.