DHX34 Antibody - middle region : HRP
Cat# ARP36417_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-DHX34 (ARP36417_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DHX34 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DHX34 (ARP36417_P050) antibody is Catalog # AAP36417 (Previous Catalog # AAPP08473) |
| Sample Type Confirmation | There is BioGPS gene expression data showing that DHX34 is expressed in HEK293T |
| Gene Symbol | DHX34 |
|---|---|
| Gene Full Name | DEAH (Asp-Glu-Ala-His) box polypeptide 34 |
| Alias Symbols | HRH1, DDX34 |
| NCBI Gene Id | 9704 |
| Description of Target | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene. |
| Uniprot ID | Q14147 |
| Protein Accession # | NP_919409 |
| Nucleotide Accession # | NM_194428 |
| Protein Size (# AA) | 1,143 |
| Molecular Weight | 128kDa |
| Protein Interactions | UBC; EXOC8; TRMT2A; RPS6KA6; GSK3B; POLA2; |
-
What is the species homology for "DHX34 Antibody - middle region (ARP36417_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "DHX34 Antibody - middle region (ARP36417_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "DHX34 Antibody - middle region (ARP36417_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "DHX34 Antibody - middle region (ARP36417_P050)"?
This target may also be called "HRH1, DDX34" in publications.
-
What is the shipping cost for "DHX34 Antibody - middle region (ARP36417_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "DHX34 Antibody - middle region (ARP36417_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "DHX34 Antibody - middle region (ARP36417_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "128kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "DHX34 Antibody - middle region (ARP36417_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DHX34"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DHX34"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DHX34"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DHX34"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DHX34"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DHX34"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.