Reagents and instruments for immunology, cell biology and molecular biology.
 
> ELF1 Antibody - C-terminal region : HRP

ELF1 Antibody - C-terminal region : HRP

Print Print
Please log in

Cat# ARP36844_P050-HRP

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-ELF1 (ARP36844_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of RAT DKFZp686H0575
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 80%; Horse: 80%; Human: 80%; Mouse: 100%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: TQETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAM
Concentration0.5 mg/ml
Blocking PeptideFor anti-ELF1 (ARP36844_P050) antibody is Catalog # AAP36844
Gene SymbolELF1
Gene Full NameE74 like ETS transcription factor 1
Alias SymbolsRIA1, EFTUD1
NCBI Gene Id1997
Protein NameETS-related transcription factor Elf-1
Description of TargetThis gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
Uniprot IDQ6MZZ4
Protein Size (# AA)361
Molecular Weight39kDa
Protein InteractionsUBC; HOXC13; SUMO2; HMGA1; SP1; NFYB; RB1; REL; NFKB1; NFYA;
Protein interactions
Name# of Products
HMGA191
NFKB1256
NFYA83
NFYB41
RB1474
REL45
SP1551
Biological pathways
Name# of Products
Positive regulation of transcription from RNA polymerase II promoter1210
Transcription, DNA-dependent3394
Biological process
Name# of Products
Negative regulation of T cell receptor signaling pathway12
Positive regulation of transcription from RNA polymerase II promoter968
Positive regulation of transcription, DNA-dependent681
Regulation of cytokine production10
Cellular components
Name# of Products
Cytoplasm4549
Nucleolus1179
Nucleus4914
Protein function
Name# of Products
Protein binding12191
Sequence-specific DNA binding1803
Sequence-specific DNA binding transcription factor activity2776

  1. What is the species homology for "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse".

  2. How long will it take to receive "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ELF1 Antibody - C-terminal region (ARP36844_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    This target may also be called "RIA1, EFTUD1" in publications.

  5. What is the shipping cost for "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ELF1 Antibody - C-terminal region (ARP36844_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ELF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ELF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ELF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ELF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ELF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ELF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.