HSD3B2 Antibody - N-terminal region : FITC

Cat# ARP44239_P050-FITC

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

HSD3B2 Antibody - N-terminal region (ARP44239_P050)

Rating:
80% of 100
Datasheets/ManualsPrintable datasheet for anti-HSD3B2 (ARP44239_P050) antibody
Product Info
Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Monkey
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 93%; Goat: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 86%; Sheep: 85%
Peptide SequenceSynthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSD3B2 (ARP44239_P050) antibody is Catalog # AAP44239 (Previous Catalog # AAPP25619)
ReferenceShigematsu,K., (2008) Eur. J. Endocrinol. 158 (6), 867-878
Gene SymbolHSD3B2
Gene Full NameHydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
Alias SymbolsHSDB, HSD3B, SDR11E2
NCBI Gene Id3284
Protein Name3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
Description of Target3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Uniprot IDP26439
Protein Accession #NP_000189
Nucleotide Accession #NM_000198
Protein Size (# AA)372
Molecular Weight42kDa
Protein InteractionsATP4A;