Ki-67 Protein (Ki67P) Recombinant, Human

Cat# 155544-10ug

Size : 10ug

Brand : US Biological

Request more information

Contact local distributor :


Phone : +1 850 650 7790


155544 Ki-67 Protein (Ki67P) Recombinant, Human

Clone Type
Polyclonal
Swiss Prot
P46013
Grade
Highly Purified
Shipping Temp
Blue Ice
Storage Temp
4°C/-70°C

Source:|Recombinant Human from E. coli||Purity:|≥95%||Endotoxin:|1.0EU per 1ug (determined by the LAL method)||Accession No:|P46013||Fragment:|Gly3088~Lys3235 (Accession No: P46013)||Sequence:|MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GIS LRSRRQNKTE AEQQITEVFV LAERIEINRN EKKPMKTSPE MDIQNPDDGA RKPIPRDKVT ENKRCLRSAR QNESSQPKVA EESGGQKSAK VLMQNQKGKG EAGNSDSMCL RSRKTKSQPA ASTLESKSVQ RVTRSVKRCA ENPKK||Epitope Tag:|N-terminal Tags: His-tag and S-tag||Molecular Weight:|22.3kD||Applications:|Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.|Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note:|Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Applications
Source: Recombinant, E. coli|Purity: ≥95%|Form: Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2.
Purity
≥95%