MFN2 Antibody - N-terminal region

Cat# ARP42419_P050-25UL

Size : 25ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

MFN2 Antibody - N-terminal region (ARP42419_P050)

Rating:
100% of 100
Datasheets/ManualsPrintable datasheet for anti-MFN2 (ARP42419_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MFN2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Peptide SequenceSynthetic peptide located within the following region: STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT
Concentration0.5 mg/ml
Blocking PeptideFor anti-MFN2 (ARP42419_P050) antibody is Catalog # AAP42419 (Previous Catalog # AAPP24764)
ReferenceChung,K.W., (2008) Neurology 70 (21), 2010-2011
Gene SymbolMFN2
Gene Full NameMitofusin 2
Alias SymbolsHSG, MARF, CMT2A, CPRP1, CMT2A2, HMSN6A, CMT2A2A, CMT2A2B
NCBI Gene Id9927
Protein NameMitofusin-2
Description of TargetMFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.
Uniprot IDO95140
Protein Accession #NP_055689
Nucleotide Accession #NM_014874
Protein Size (# AA)757
Molecular Weight86kDa
Protein InteractionsUBC; MARCH5; PARK2; UBE2N; MFN2; TER94; MAVS; vpr; HUWE1; MAPK9;