MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2)
Cat# 129613-100ug
Size : 100ug
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
129613 MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2bGrade
Affinity PurifiedApplications
E IF WBCrossreactivity
HuAccession #
NM_031433, NP_113621Shipping Temp
Blue IceStorage Temp
-20°CMay play a role in eye development.||Applications:|Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Immunofluorescence: 10ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Applications
Product Type: Mab|Isotype: IgG2b|Clone No: 1E12|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.4.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant protein corresponding to aa480-579 from human MFRP with GST tag. MW of the GST tag alone is 26kD. expressed in E. coli. |Specificity: Recognizes human MFRP.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant protein corresponding to aa480-579 from human MFRP with GST tag. MW of the GST tag alone is 26kD. expressed in E. coli.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MFRP.
You might also be interested by the following products:
Cat#
Description
Cond.
Price Bef. VAT