Clinisciences > MXI1 Antibody - middle region : FITC
MXI1 Antibody - middle region : FITC
Brand : Aviva Systems Biology
Request more information
Please log in to use this feature.
Bulk
Order
Order
Aviva's
Satisfaction
Guarantee
Satisfaction
Guarantee
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- : Antibody & Protein in US
- + /Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-MXI1 (ARP31403_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse | ||
---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast, Zebrafish | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | IHC, WB | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MXI1 | ||
Purification | Affinity Purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 79% | ||
Peptide Sequence | Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM | ||
Concentration | 0.5 mg/ml | ||
Blocking Peptide | For anti-MXI1 (ARP31403_P050) antibody is Catalog # AAP31403 (Previous Catalog # AAPS15701) | ||
Enhanced Validation |
|
Reference | Dugast-Darzacq,C., et al., (2004) Oncogene 23 (55), 8887-8899 |
---|---|
Gene Symbol | MXI1 |
Gene Full Name | MAX interactor 1 |
Alias Symbols | MXI, MAD2, MXD2, bHLHc11 |
NCBI Gene Id | 4601 |
Protein Name | Max-interacting protein 1 |
Description of Target | Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The MXI1 gene encodes a transcriptional repressor protein thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in MXI1 are frequently found in patients with prostate tumors.Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally. |
Uniprot ID | P50539 |
Protein Accession # | NP_569157 |
Nucleotide Accession # | NM_130439 |
Protein Size (# AA) | 295 |
Molecular Weight | 26kDa |
Protein Interactions | NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-9; KRTAP10-7; KRT40; RPL23AP32; CALCOCO2; MAX; ENTPD5; UBC; APP; CDC20; BUB1B; SIN3B; SIN3A; SMC3; MYC; |
Protein interactions
Name | # of Products |
---|---|
MAX | 94 |
MYC | 816 |
SIN3A | 346 |
SIN3B | 75 |
SMC3 | 77 |
UBC | 7030 |
Biological process
Name | # of Products |
---|---|
Cytoplasmic sequestering of transcription factor | 11 |
Negative regulation of cell proliferation | 375 |
Regulation of transcription, DNA-dependent | 1734 |
Cellular components
Name | # of Products |
---|---|
Nucleus | 4914 |
Protein function
Name | # of Products |
---|---|
DNA binding | 3958 |
Transcription corepressor activity | 425 |
Diseases
Name | # of Products |
---|---|
Disease mutation | 5332 |
Proto-oncogene | 793 |
- Mxi1 Antibody - N-terminal region (ARP36812_P050)Catalog #: ARP36812_P050Species Tested: Human, MouseApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- MXI1 Antibody - middle region (ARP31402_P050)Catalog #: ARP31402_P050Species Tested: Human, MouseApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.