Myf5 Antibody - middle region : FITC
Cat# ARP31407_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Myf5 (ARP31407_P050) antibody |
---|
Tested Species Reactivity | Rat |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat Myf5 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-Myf5 (ARP31407_P050) antibody is Catalog # AAP31407 |
Gene Symbol | Myf5 |
---|---|
Alias Symbols | - |
NCBI Gene Id | 299766 |
Protein Name | Myogenic factor 5 (Predicted) EMBL EDM16769.1 |
Description of Target | The function of this protein remains unknown. |
Uniprot ID | D3ZVU3 |
Protein Accession # | NP_001100253 |
Nucleotide Accession # | NM_001106783 |
Protein Size (# AA) | 255 |
Molecular Weight | 28kDa |