Profilin 2 (PFN2) (NM_053024) Human Tagged ORF Clone

CAT#: RC207366

PFN2 (Myc-DDK-tagged)-Human profilin 2 (PFN2), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK

Datasheet
SDS
Plasmid Map

Product Images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Profilin 2
Synonyms D3S1319E; PFL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207366 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGTTGGCAGAGCTACGTGGATAACCTGATGTGCGATGGCTGCTGCCAGGAGGCCGCCATTGTCG
GCTACTGCGACGCCAAATACGTCTGGGCAGCCACGGCCGGGGGCGTCTTTCAGAGCATTACGCCAATAGA
AATAGATATGATTGTAGGAAAAGACCGGGAAGGTTTCTTTACCAACGGTTTGACTCTTGGCGCGAAGAAA
TGCTCAGTGATCAGAGATAGTCTATACGTCGATGGTGACTGCACAATGGACATCCGGACAAAGAGTCAAG
GTGGGGAGCCAACATACAATGTGGCTGTCGGCAGAGCTGGTAGAGTCTTGGTCTTTGTAATGGGAAAAGA
AGGGGTCCATGGAGGCGGATTGAATAAGAAGGCATACTCAATGGCAAAATACTTGAGAGACTCTGGGTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
>RC207366 protein sequence
Red=Cloning site Green=Tags(s)

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK
CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_053024
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_053024.4
RefSeq Size 2117 bp
RefSeq ORF 423 bp
Locus ID 5217
UniProt ID P35080
Cytogenetics 3q25.1
Domains PROF
Protein Families Druggable Genome
Protein Pathways Regulation of actin cytoskeleton
MW 15 kDa
Gene Summary The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008]

Other Versions

SKU Description Size
RC207366L3 Lenti ORF clone of Human profilin 2 (PFN2), transcript variant 1, Myc-DDK-tagged
    • 10 ug

450,00 EUR

RC207366L4 Lenti ORF clone of Human profilin 2 (PFN2), transcript variant 1, mGFP tagged
    • 10 ug

450,00 EUR

RG207366 PFN2 (tGFP-tagged) - Human profilin 2 (PFN2), transcript variant 1
    • 10 ug

350,00 EUR

SC107927 PFN2 (untagged)-Human profilin 2 (PFN2), transcript variant 1
    • 10 ug

150,00 EUR