SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1)
Cat# 132993-100ug
Size : 100ug
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
132993 SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
Hu Mo RtAccession #
NM_016240, NP_057324Shipping Temp
Blue IceStorage Temp
-20°CApplications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 3A2|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.2.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human SCARA3. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SCARA3. Species Crossreactivity: mouse and rat.