SOX21 Rabbit Polyclonal Antibody
Cat# TA329317
Size : 100ul
Contact local distributor :
| Product Data | |
| Application | WB |
|---|---|
| Application | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SOX21 antibody: synthetic peptide directed towards the middle region of human SOX21. Synthetic peptide located within the following region: EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 28 kDa |
| Gene Name | SRY-box 21 |
| Database Link | |
| Background | SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148). [supplied by OMIM, Apr 2004] |
| Synonyms | SOX25 |
| Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 86% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
|
| SDS |
| Antibody Resources |
|
Related Products
Check items to add to the cart or
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.