SRD5A2 Antibody - N-terminal region : Biotin

Cat# ARP44264_P050-Biotin

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

SRD5A2 Antibody - N-terminal region (ARP44264_P050)

Rating:
80% of 100
Datasheets/ManualsPrintable datasheet for anti-SRD5A2 (ARP44264_P050) antibody
Product Info
Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityHuman, Pig, Rabbit, Monkey
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 86%; Rabbit: 91%
Peptide SequenceSynthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Gene SymbolSRD5A2
Gene Full NameSteroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Alias SymbolsMGC138457
NCBI Gene Id6716
Protein Name3-oxo-5-alpha-steroid 4-dehydrogenase 2
Description of TargetThis gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Uniprot IDQ28892
Protein Accession #NP_000339
Nucleotide Accession #NM_000348
Protein Size (# AA)254
Molecular Weight28kDa