Clinisciences > TBP Antibody - middle region : Biotin
TBP Antibody - middle region : Biotin
Brand : Aviva Systems Biology
Request more information
Please log in to use this feature.
Datasheets/Manuals | Printable datasheet for anti-TBP (P100971_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBP |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-TBP (P100971_T100) antibody is Catalog # AAP31331 (Previous Catalog # AAPP02082) |
Reference | Reid,S.J., et al., (2004) Brain Res. Mol. Brain Res. 125 (1-2), 120-128 |
---|---|
Gene Symbol | TBP |
Gene Full Name | TATA box binding protein |
Alias Symbols | HDL4, GTF2D, SCA17, TFIID, GTF2D1 |
NCBI Gene Id | 6908 |
Protein Name | TATA-box-binding protein |
Description of Target | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. |
Uniprot ID | P20226 |
Protein Accession # | NP_003185 |
Nucleotide Accession # | NM_003194 |
Protein Size (# AA) | 339 |
Molecular Weight | 38kDa |
Protein Interactions | DR1; SSX2IP; GOLGA2; MEF2A; TAF8; GNG12; GNB2; UBC; UBE2I; TAF10; TAF5; HNF4A; E2F1; PAX5; TAF1A; TCEA1; RUVBL2; Abt1; GTF2A2; ICE2; tat; MED26; TBP; TAF6; TAF4; TAF1; SP1; TP53; SNAPC2; SNAPC1; MUC1; Taf1c; Taf1b; GTF2B; HCVgp1; AHR; TAF9B; BTAF1; TAF13; |
Protein interactions
Name | # of Products |
---|---|
ALL1 | 28 |
ATXN7 | 153 |
BRD2 | 26 |
BRF1 | 18 |
CPSF1 | 47 |
CPSF2 | 14 |
CPSF3 | 11 |
CREBBP | 802 |
CTD | 13 |
DDX5 | 83 |
DRAP1 | 37 |
E2F1 | 177 |
ELF3 | 34 |
EP300 | 986 |
ESR1 | 695 |
GTF2A1 | 30 |
GTF2B | 130 |
HDAC1 | 928 |
MKX | 11 |
POU3F2 | 29 |
REST | 31 |
SETD7 | 40 |
Sin3a | 346 |
SMARCA2 | 160 |
SPI1 | 86 |
T | 51 |
TAF1 | 88 |
TAF10 | 95 |
TAF11 | 67 |
TAF12 | 43 |
TAF1C | 30 |
TAF1D | 93 |
TAF2 | 23 |
TAF3 | 13 |
TAF4 | 54 |
TAF4B | 8 |
TAF5 | 38 |
TAF6 | 70 |
TAF7 | 68 |
TAF8 | 20 |
TAF9 | 108 |
Tat | 632 |
TBP | 255 |
TCF12 | 48 |
TP53 | 1010 |
ZNF76 | 5 |
Biological pathways
Name | # of Products |
---|---|
Cell death | 254 |
Interspecies interaction between organisms | 817 |
Transcription elongation from RNA polymerase II promoter | 109 |
Transcription from RNA polymerase III promoter | 19 |
Transcription initiation from RNA polymerase II promoter | 112 |
Viral reproduction | 431 |
Biological process
Name | # of Products |
---|---|
Cell death | 133 |
Gene expression | 503 |
Interspecies interaction between organisms | 281 |
Positive regulation of transcription, DNA-dependent | 681 |
Spermatogenesis | 230 |
Transcription elongation from RNA polymerase II promoter | 54 |
Transcription from RNA polymerase II promoter | 302 |
Transcription from RNA polymerase III promoter | 33 |
Transcription initiation from RNA polymerase II promoter | 69 |
Viral reproduction | 279 |
Cellular components
Name | # of Products |
---|---|
Cytoplasm | 4549 |
Female pronucleus | 9 |
Male pronucleus | 6 |
Nuclear euchromatin | 14 |
Nucleoplasm | 775 |
Transcription factor TFIIA complex | 5 |
Transcription factor TFIID complex | 19 |
Protein function
Name | # of Products |
---|---|
Binding | 1030 |
DNA binding | 3958 |
Protein binding | 12191 |
Repressing transcription factor binding | 106 |
Sequence-specific DNA binding transcription factor activity | 2776 |
Transcription factor binding | 934 |
Transcription regulatory region DNA binding | 657 |
Diseases
Name | # of Products |
---|---|
Disease mutation | 5332 |
Neurodegeneration | 458 |
Spinocerebellar ataxia | 40 |
- TBP Antibody - C-terminal region (OAAB03732)Catalog #: OAAB03732Application: IF, WBFormat: Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS.Size: 400ul
- TBP Antibody - N Terminus (OAEB02595)Catalog #: OAEB02595Application: WBFormat: Supplied at 0.5 mg/ml in Tris saline, 0.02% sodium azide, pH7.3 with 0.5% bovine serum albumin. Aliquot and store at -20°C. Minimize freezing and thawing.Size: 100UG
- TBP Polyclonal Antibody (OABB00488)Catalog #: OABB00488Clone: PolyclonalSpecies Tested: HumanApplication: WBFormat: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.Size: 100UG
- TBP Antibody (1F6) (OASG07062)Catalog #: OASG07062Application: IF, IHC, IP, WBFormat: Liquid. 1 mg/mL in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL
- TBP Antibody - middle region (OASG07128)Catalog #: OASG07128Application: ELISA, IF, IHC, WBFormat: Liquid. 1 mg/mL in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL