Tcf3 Antibody - C-terminal region
Cat# ARP30966_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Tcf3 (ARP30966_P050) antibody |
---|
Tested Species Reactivity | Rat |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tcf3 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | Available upon request |
Gene Symbol | Tcf3 |
---|---|
Gene Full Name | transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) |
Alias Symbols | Pan2, Tcfe2a |
NCBI Gene Id | 171046 |
Protein Name | Transcription factor E2-alpha |
Description of Target | Tcf3 is a transcriptional regulator; It binds enhancer motifs of pancreatic exocrine genes. |
Uniprot ID | P21677 |
Protein Accession # | NP_598208 |
Nucleotide Accession # | NM_133524 |
Protein Size (# AA) | 649 |
Molecular Weight | 71kDa |
Protein Interactions | Dact2; Psmd9; Twist1; Id3; |