Tcf3 Antibody - C-terminal region

Cat# ARP30966_P050-25UL

Size : 25ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

Tcf3 Antibody - C-terminal region (ARP30966_P050)

Datasheets/ManualsPrintable datasheet for anti-Tcf3 (ARP30966_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tcf3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolTcf3
Gene Full Nametranscription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Alias SymbolsPan2, Tcfe2a
NCBI Gene Id171046
Protein NameTranscription factor E2-alpha
Description of TargetTcf3 is a transcriptional regulator; It binds enhancer motifs of pancreatic exocrine genes.
Uniprot IDP21677
Protein Accession #NP_598208
Nucleotide Accession #NM_133524
Protein Size (# AA)649
Molecular Weight71kDa
Protein InteractionsDact2; Psmd9; Twist1; Id3;