TMF1 Antibody - middle region : HRP
Cat# P100705_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-TMF1 (P100705_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TMF1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92% |
Peptide Sequence | Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-TMF1 (P100705_P050) antibody is Catalog # AAP31060 (Previous Catalog # AAPP01794) |
Sample Type Confirmation | There is BioGPS gene expression data showing that TMF1 is expressed in MCF7 |
Reference | Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485 |
---|---|
Gene Symbol | TMF1 |
Gene Full Name | TATA element modulatory factor 1 |
Alias Symbols | TMF, ARA160 |
NCBI Gene Id | 7110 |
Protein Name | TATA element modulatory factor |
Description of Target | TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP). |
Uniprot ID | P82094 |
Protein Accession # | NP_009045 |
Nucleotide Accession # | NM_007114 |
Protein Size (# AA) | 1093 |
Molecular Weight | 123kDa |
Protein Interactions | UBC; NR3C1; GFI1B; ITSN2; KAT2B; PLK1; SMARCA4; AR; RAB6A; FER; |