Ubiquitin-like Protein SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (SMT3)

Cat# 370795-100ug

Size : 100ug

Brand : US Biological

Request more information

Contact local distributor :


Phone : +1 850 650 7790


370795 Ubiquitin-like Protein SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (SMT3)

Clone Type
Polyclonal
Swiss Prot
Q12306
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Not known; suppressor of MIF2 mutations.||Source:|Recombinant protein corresponding to aa2-98 from Saccharomyces cerevisiae SMT3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.||Molecular Weight:|~27.12kD||Amino Acid Sequence:|SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Purity
≥90% (SDS-PAGE)
References
1. Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000).