YY1 Antibody - middle region : Biotin
Cat# P100898_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
YY1 Antibody - middle region (P100898_P050)
| Datasheets/Manuals | Printable datasheet for anti-YY1 (P100898_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YY1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-YY1 (P100898_P050) antibody is Catalog # AAP31246 (Previous Catalog # AAPP01991) |
| Reference | Gronroos,E., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12165-12170 |
|---|---|
| Gene Symbol | YY1 |
| Gene Full Name | YY1 transcription factor |
| Alias Symbols | DELTA, NF-E1, UCRBP, GADEVS, INO80S, YIN-YANG-1 |
| NCBI Gene Id | 7528 |
| Protein Name | Transcriptional repressor protein YY1 |
| Description of Target | YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. |
| Uniprot ID | P25490 |
| Protein Accession # | NP_003394 |
| Nucleotide Accession # | NM_003403 |
| Protein Size (# AA) | 414 |
| Molecular Weight | 45kDa |
| Protein Interactions | HDAC1; SMURF2; UBC; SHFM1; RNF2; BMI1; SUZ12; RYBP; GABPB1; GABPA; PCGF2; RING1; EP300; LAMC2; SPRY1; SLC39A7; NR1H2; TESK1; RAF1; NFKB1; GRN; CRKL; ARRB1; SP1; WDHD1; ZNF24; NHP2L1; NCL; ZNF830; APP; ZNF638; EED; SMAD3; SMAD2; EZH2; SUMO1; SUMO3; INO80E; |
