ALDOB Antibody - N-terminal region : HRP

Referencia ARP41364_P050-HRP

embalaje : 100ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

ALDOB Antibody - N-terminal region (ARP41364_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ALDOB (ARP41364_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDOB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 90%; Zebrafish: 75%
Peptide SequenceSynthetic peptide located within the following region: ADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHE
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALDOB (ARP41364_P050) antibody is Catalog # AAP41364
Gene SymbolALDOB
Gene Full Namealdolase B, fructose-bisphosphate
Alias SymbolsALDB, ALDO2
NCBI Gene Id229
Protein NameFructose-bisphosphate aldolase B
Description of TargetFructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.
Uniprot IDP05062
Protein Accession #NP_000026
Protein Size (# AA)364
Molecular Weight40kDa
Protein InteractionsBBS7; BBS4; BBS2; BBS1; MUC20; AGXT2; TXN2; UBC; HIVEP1; ALDOA; APP; HSPA8; ALDOB; ATP6V1E1;