C2orf33 Antibody - C-terminal region : Biotin

Referencia ARP49483_P050-Biotin

embalaje : 100ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

C2orf33 Antibody - C-terminal region (ARP49483_P050)

Datasheets/ManualsPrintable datasheet for anti-MFF (ARP49483_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
Concentration0.5 mg/ml
Blocking PeptideFor anti-MFF (ARP49483_P050) antibody is Catalog # AAP49483 (Previous Catalog # AAPS25106)
ReferenceGregory,S.G., (2008) Mol. Biol. Cell 19 (6), 2402-2412
Gene SymbolMFF
Gene Full NameMitochondrial fission factor
Alias SymbolsEMPF2, GL004, C2orf33
NCBI Gene Id56947
Protein NameMitochondrial fission factor
Description of TargetThe exact function of C2orf33 remains unknown.
Uniprot IDQ9GZY8
Protein Accession #NP_064579
Nucleotide Accession #NM_020194
Protein Size (# AA)342
Molecular Weight38kDa
Protein InteractionsMFF; DNM1L; YWHAQ; UBC; DDX28; ILF3;