HMGB1 Protein
Referencia OPPA01571
embalaje : 10ug
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
HMGB1 Protein (OPPA01571)
| Datasheets/Manuals | Printable datasheet for OPPA01571 |
|---|
| Predicted Species Reactivity | Human |
|---|---|
| Product Format | Lyophilized from a 0.2 um filtered concentrated solution in PBS (pH 7.4) |
| Host | E. Coli |
| Reconstitution and Storage | It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M-omega-cm H2O not less than 100 ug/mL, which can then be further diluted to other aqueous solutions. Lyophilized HMGB1, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze/thaw cycles. |
| Purification | The HMGB-1 is purified by proprietary chromatographic techniques. |
| Purity | Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Peptide Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH. |
| Tag | 6xHis tag |
| Gene Symbol | HMGB1 |
|---|---|
| Alias Symbols | HMG1, HMG3, HMG-1, SBP-1 |
| NCBI Gene Id | 3146 |
| Protein Name | High mobility group protein B1 |
| Description of Target | HMG1 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids. |
| Uniprot ID | P09429 |
| Protein Accession # | NP_002119.1 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 26 kDa |
