HOXD10 Antibody - middle region : FITC
Referencia P100936_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
HOXD10 Antibody - middle region (P100936_P050)
| Datasheets/Manuals | Printable datasheet for anti-HOXD10 (P100936_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HOXD10 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HOXD10 (P100936_P050) antibody is Catalog # AAP31289 (Previous Catalog # AAPP02038) |
| Reference | Gurnett,C.A., Clin. Orthop. Relat. Res. 462, 27-31 (2007) |
|---|---|
| Gene Symbol | HOXD10 |
| Gene Full Name | Homeobox D10 |
| Alias Symbols | HOX4, HOX4D, HOX4E, Hox-4.4 |
| NCBI Gene Id | 3236 |
| Protein Name | Homeobox protein Hox-D10 |
| Description of Target | HOXD10 is the sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as 'rocker-bottom foot' deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P28358 |
| Protein Accession # | NP_002139 |
| Nucleotide Accession # | NM_002148 |
| Protein Size (# AA) | 340 |
| Molecular Weight | 38kDa |
| Protein Interactions | EP300; CREBBP; PBX1; GMNN; HMGB1; |