HSD17B11 Antibody - N-terminal region : HRP
Referencia ARP40843_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-HSD17B11 (ARP40843_P050) antibody |
---|
Tested Species Reactivity | Monkey |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Monkey |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92% |
Peptide Sequence | Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HSD17B11 (ARP40843_P050) antibody is Catalog # AAP40843 (Previous Catalog # AAPY01095) |
Gene Symbol | HSD17B11 |
---|---|
Gene Full Name | Hydroxysteroid (17-beta) dehydrogenase 11 |
Alias Symbols | DHRS8, PAN1B, RETSDR2, SDR16C2, 17BHSD11, 17-BETA-HSD11, 17-BETA-HSDXI |
NCBI Gene Id | 51170 |
Protein Name | Estradiol 17-beta-dehydrogenase 11 |
Description of Target | Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]). |
Uniprot ID | Q8NBQ5 |
Protein Accession # | NP_057329 |
Nucleotide Accession # | NM_016245 |
Protein Size (# AA) | 300 |
Molecular Weight | 33kDa |
Protein Interactions | FBXO6; UBD; UBC; ELAVL1; |