HSP90AA1 antibody - N-terminal region
Referencia ARP30184_P050
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-HSP90AA1 (ARP30184_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Sheep |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Additional Information | IHC Information: Tonsil IHC Information: Colon, myenteric plexus |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92% |
Peptide Sequence | Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HSP90AA1 (ARP30184_P050) antibody is Catalog # AAP30184 (Previous Catalog # AAPS08910) |
Sample Type Confirmation | HSP90AA1 is strongly supported by BioGPS gene expression data to be expressed in MCF7 |
Reference | Onuoha,S.C., (2008) J. Mol. Biol. 379 (4), 732-744 |
Gene Symbol | HSP90AA1 |
---|---|
Gene Full Name | Heat shock protein 90kDa alpha (cytosolic), class A member 1 |
Alias Symbols | EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p |
NCBI Gene Id | 3320 |
Protein Name | Heat shock protein HSP 90-alpha |
Description of Target | HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219). |
Uniprot ID | P07900 |
Protein Accession # | NP_001017963 |
Nucleotide Accession # | NM_001017963 |
Protein Size (# AA) | 854 |
Molecular Weight | 98kDa |
Protein Interactions | AHSA1; STUB1; HUWE1; ISG15; RAF1; PTGDS; PTGDR; SIRT1; CDC37; STIP1; HSF1; HIF1A; NR3C1; UBC; PTGES3; FUS; CDC25C; CDK1; SUMO1; STK36; KEAP1; PSMD10; AURKA; SUMO2; SUMO3; MAP3K11; MDM2; LGALS3BP; CEP57; AURKB; CEP76; VHL; TUBG1; TP53; BRCA1; CEP250; AIP; |
-
What is the species homology for "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Sheep".
-
How long will it take to receive "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
This target may also be called "EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p" in publications.
-
What is the shipping cost for "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "98kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HSP90AA1 Antibody - N-terminal region (ARP30184_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HSP90AA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HSP90AA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HSP90AA1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HSP90AA1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HSP90AA1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HSP90AA1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.