600132 | Human IL-10 Clinisciences

Recombinant Active Protein

Cat. No.

600132

Unit

0.01 mg

Description

Interleukin-10 (IL-10) is produced by murine T-cells following their stimulation by lectins. The main source for B-cell-derived IL-10 in mice are Ly-1 B-cells that express CD5 and CD11 . Murine keratinocytes also produce IL10. In humans IL-10 is produced by activated CD8(+) peripheral blood T-cells, by T-helper CD4 (+) T-cell clones (resembling Th0 , Th1 , and Th2 ) after both antigen-specific and polyclonal activation, by B-cell lymphomas, and by monocytes following cell activation by bacterial lipopolysaccharides and mast cells. B-cell lines derived from patients with acquired immunodeficiency syndrome and Burkitt's lymphoma constitutively secrete large quantities of IL-10 into the conditioned medium . The synthesis of IL-10 by monocytes is inhibited by IL-4 and IL-10. Recombinant Human IL-10 produced in E. coli is a single non-glycosylated polypeptide chain containing 161 amino acids with a MW of 16.6 kDa.

Spec Container

Datasheet

Format

Each vial contains 10 ug protein lyophilized in 10 mM sodium phosphate pH7.5. Reconstitute with 0.1 ml sterile deionized water for a final concentration of 0.1 mg/ml.

Alternate Names

interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF; IL10

Accession No.

P22301

16600 Da

Sequence

MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQM KDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQ AENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSK AVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Source

E. coli. Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.

Purity

Purity Approximately 90% as determined by reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard

Application Notes

Interleukin-10 is fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of mouse MC-9 cells was found to be < 0.5 ng/ml, corresponding to a Specific Activity of 3 x 106 IU/mg.

Storage

Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.

Images

For research use only, not for diagnostic or therapeutic procedures.

Human IL-10

Referencia 600132

Contact local distributor :

Marca : Abbiotec

Contact local distributor :

Spec Container