LASS6 monoclonal antibody (M02), clone 6B8
* The price is valid only in USA. Please select country.
- More Files
Western Blot (Cell lysate)
LASS6 monoclonal antibody (M02), clone 6B8 Western Blot analysis of LASS6 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
LASS6 monoclonal antibody (M02), clone 6B8. Western Blot analysis of LASS6 expression in PC-12(Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LASS6 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.44 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant LASS6.
Immunogen
LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
LASS6 monoclonal antibody (M02), clone 6B8 Western Blot analysis of LASS6 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
LASS6 monoclonal antibody (M02), clone 6B8. Western Blot analysis of LASS6 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LASS6 is approximately 0.1ng/ml as a capture antibody.ELISA
- Gene Info — LASS6
Entrez GeneID
253782GeneBank Accession#
NM_203463Protein Accession#
NP_982288Gene Name
LASS6
Gene Alias
CerS6, MGC129949, MGC129950
Gene Description
LAG1 homolog, ceramide synthase 6
Gene Ontology
HyperlinkGene Summary
O
Other Designations
LAG1 longevity assurance homolog 6|longevity assurance homolog 6
- Interactomes
- Diseases