MFN1 Antibody - middle region

Referencia ARP57702_P050-25UL

embalaje : 25ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

MFN1 Antibody - middle region (ARP57702_P050)

Rating:
60% of 100
Datasheets/ManualsPrintable datasheet for anti-MFN1 (ARP57702_P050) antibody
Product Info
Publications

Bonala, S. et al. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Mol. Endocrinol. 27, 1518-35 (2013). 23927930

Papanicolaou, K. N. et al. Mitofusin-2 maintains mitochondrial structure and contributes to stress-induced permeability transition in cardiac myocytes. Mol. Cell. Biol. 31, 1309-28 (2011). 21245373

More...

Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MFN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MFN1 (ARP57702_P050) antibody is Catalog # AAP57702 (Previous Catalog # AAPP42948)
Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolMFN1
Gene Full NameMitofusin 1
Alias Symbolshfzo1, hfzo2
NCBI Gene Id55669
Protein NameMitofusin-1
Description of TargetThe protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.
Uniprot IDQ8R4Z9
Protein Accession #NP_284941
Nucleotide Accession #NM_033540
Protein Size (# AA)741
Molecular Weight84 kDa
Protein InteractionsPARK2; MARCH5; UBC; TER94; MAVS; CCNB1; ILF2; BAK1;