Myf5 Antibody - middle region : FITC

Referencia ARP31407_P050-FITC

embalaje : 100ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

Myf5 Antibody - middle region (ARP31407_P050)

Datasheets/ManualsPrintable datasheet for anti-Myf5 (ARP31407_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Rat Myf5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN
Concentration0.5 mg/ml
Blocking PeptideFor anti-Myf5 (ARP31407_P050) antibody is Catalog # AAP31407
Gene SymbolMyf5
Alias Symbols-
NCBI Gene Id299766
Protein NameMyogenic factor 5 (Predicted) EMBL EDM16769.1
Description of TargetThe function of this protein remains unknown.
Uniprot IDD3ZVU3
Protein Accession #NP_001100253
Nucleotide Accession #NM_001106783
Protein Size (# AA)255
Molecular Weight28kDa