Myf5 Antibody - middle region : FITC
Referencia ARP31407_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Myf5 Antibody - middle region (ARP31407_P050)
| Datasheets/Manuals | Printable datasheet for anti-Myf5 (ARP31407_P050) antibody |
|---|
| Tested Species Reactivity | Rat |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat Myf5 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Myf5 (ARP31407_P050) antibody is Catalog # AAP31407 |
| Gene Symbol | Myf5 |
|---|---|
| Alias Symbols | - |
| NCBI Gene Id | 299766 |
| Protein Name | Myogenic factor 5 (Predicted) EMBL EDM16769.1 |
| Description of Target | The function of this protein remains unknown. |
| Uniprot ID | D3ZVU3 |
| Protein Accession # | NP_001100253 |
| Nucleotide Accession # | NM_001106783 |
| Protein Size (# AA) | 255 |
| Molecular Weight | 28kDa |
