Prdx6 (BC013489) Mouse Tagged ORF Clone

Referencia MG202605

embalaje : 10ug

Solicitar más información

Contact local distributor :


Teléfono :

Prdx6 (BC013489) Mouse Tagged ORF Clone

Specifications
Product Data
Target Symbol Prdx6
Synonyms Prdx6-rs3, Aop2-rs3, GPx, aiPLA2, Prdx5, CP-3, ORF06, 1-cysPrx, mKIAA0106
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202605 representing BC013489
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGGAGGGTTGCTTCTCGGGGACGAAGCCCCCAACTTTGAGGCCAATACCACCATCGGCCGCATCC
GCTTCCACGATTTCCTGGGAGATTCATGGGGCATTCTCTTTTCCCACCCACGGGACTTTACCCCAGTGTG
CACCACAGAACTTGGCAGAGCTGCAAAGCTGGCGCCAGAGTTTGCCAAGAGGAATGTTAAGTTGATTGCT
CTTTCAATAGACAGTGTTGAGGATCATCTTGCCTGGAGCAAGGACATCAATGCTTACAATGGTGAAACAC
CCACGGAAAAGTTGCCATTTCCCATCATTGATGATAAGGGCAGGGACCTTGCCATCCTTTTGGGCATGTT
GGATCCAGTCGAGAAGGACGCTAACAACATGCCTGTGACGGCCCGTGTGGTGTTCATTTTTGGCCCTGAC
AAGAAACTGAAGCTGTCTATCCTCTACCCTGCCACCACGGGCAGGAACTTTGATGAGATTCTCAGAGTGG
TTGACTCTCTCCAGCTGACAGGCACAAAGCCGGTTGCCACCCCAGTTGACTGGAAGAAGGGAGAGAGCGT
GATGGTAGTTCCCACCCTCTCCGAAGAGGAAGCCAAACAATGTTTCCCTAAAGGAGTCTTCACCAAAGAG
CTCCCGTCTGGCAAAAAATACCTCCGTTATACACCCCAGCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202605 representing BC013489
Red=Cloning site Green=Tags(s)

MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA
LSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDANNMPVTARVVFIFGPD
KKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKE
LPSGKKYLRYTPQP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC013489
ORF Size 674 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC013489, AAH13489
RefSeq Size 1440 bp
RefSeq ORF 674 bp
Locus ID 11758
Cytogenetics 1 69.75 cM
Summary This gene encodes a member of the peroxiredoxin family of peroxidases. The encoded protein is a bifunctional enzyme that has glutathione peroxidase and phospholipase activities. This protein is an antioxidant that reduces peroxidized membrane phospholipids and plays an important role in phospholipid homeostasis based on its ability to generate lysophospholipid substrate for the remodeling pathway of phospholipid synthesis. Mice lacking this gene are sensitive to oxidant stress, have altered lung phospholipid metabolism and susceptible to skin tumorigenesis. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Dec 2014]
Write Your Own Review
You're reviewing:Prdx6 (BC013489) Mouse Tagged ORF Clone
Your Rating
SKU Description Size
MR202605 Prdx6 (Myc-DDK-tagged) - Mouse peroxiredoxin 6 (cDNA clone MGC:19131 IMAGE:4215591) 10 ug
MR202605L3 Lenti ORF clone of Prdx6 (Myc-DDK-tagged) - Mouse peroxiredoxin 6 (cDNA clone MGC:19131 IMAGE:4215591) 10 ug
MR202605L4 Lenti ORF clone of Prdx6 (mGFP-tagged) - Mouse peroxiredoxin 6 (cDNA clone MGC:19131 IMAGE:4215591) 10 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA