SLC2A2 Antibody - N-terminal region : FITC
Referencia ARP41706_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-SLC2A2 (ARP41706_P050) antibody |
---|
Publications | Maternal Heat Stress Alters Expression of Genes Associated with Nutrient Transport Activity and Metabolism in Female Placentae from Mid-Gestating Pigs. Int J Mol Sci. 22 (2021). 339237471$s> Mechanism of insulin resistance in a rat model of kidney disease and the risk of developing type 2 diabetes. PLoS One. 12, e0176650 (2017). 284598621$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC2A2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 79%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 92% |
Peptide Sequence | Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SLC2A2 (ARP41706_P050) antibody is Catalog # AAP41706 (Previous Catalog # AAPP24349) |
Reference | Laukkanen,O., (2005) Diabetes 54 (7), 2256-2260 |
---|---|
Gene Symbol | SLC2A2 |
Gene Full Name | Solute carrier family 2 (facilitated glucose transporter), member 2 |
Alias Symbols | GLUT2 |
NCBI Gene Id | 6514 |
Protein Name | Solute carrier family 2, facilitated glucose transporter member 2 |
Description of Target | Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. |
Uniprot ID | P11168 |
Protein Accession # | NP_000331 |
Nucleotide Accession # | NM_000340 |
Protein Size (# AA) | 524 |
Molecular Weight | 58kDa |
Protein Interactions | APP; PRKACA; PDX1; KPNA2; HNRNPL; |